Visual UI Debug Agent MCP

by samihalawa• 84•• Scanned•Claim this listing•Request removal
Coding Agentsagentaiautomatedautomationautonomous agents

Visual UI testing and debugging MCP server with Playwright, screenshots, DOM inspection, workflow validation, and visual diffs.

Visual UI Debug Agent MCP is an open-source mcp server by samihalawa, written mainly in JavaScript, with 84 GitHub stars and the ISC license. Its code was last updated Oct 1, 2026. The latest npm release is visual-ui-debug-agent-mcp 1.1.0, published Aug 11, 2026, with 34 downloads last week.

Scan summary: scanned Nov 5, 2026 at commit 33af9e8. Seen able to run dynamic code, control a web browser. Scan policy

aboutREADMEsecurityreviews

How to install Visual UI Debug Agent MCP

Built from the start command in the project's README: npx -y visual-ui-debug-agent-mcp. Check the README for required keys or settings.

Claude Code · Terminal
claude mcp add visual-ui-debug-agent-mcp -- npx -y visual-ui-debug-agent-mcp
Claude Desktop · claude_desktop_config.json
{
  "mcpServers": {
    "visual-ui-debug-agent-mcp": {
      "command": "npx",
      "args": [
        "-y",
        "visual-ui-debug-agent-mcp"
      ]
    }
  }
}
Cursor · .cursor/mcp.json
{
  "mcpServers": {
    "visual-ui-debug-agent-mcp": {
      "command": "npx",
      "args": [
        "-y",
        "visual-ui-debug-agent-mcp"
      ]
    }
  }
}
VS Code · Terminal
code --add-mcp '{"name":"visual-ui-debug-agent-mcp","command":"npx","args":["-y","visual-ui-debug-agent-mcp"]}'

What Visual UI Debug Agent MCP can touch

  • Run shell commandsNot seen in this scan
  • Run dynamic codeListed as a tool: playwright_evaluate
  • Read or write filesNot seen in this scan
  • Read environment and secretsNot seen in this scan
  • Control a web browserListed as a tool: screenshot_url
  • Connect to databasesNot seen in this scan
  • Read or send messagesNot seen in this scan
  • Touch money or tradingNot seen in this scan
  • Connect to the internetNo connections seen while running

"Not seen" means our checks did not find it, and the tool may still do it. Covers commit 33af9e8, Nov 5, 2026. See the scan policy.

Before you install Visual UI Debug Agent MCP

AgenticMart scanned Visual UI Debug Agent MCP on Nov 5, 2026 with automated checks for hidden code, known-malicious packages, leaked secrets and vulnerable dependencies. The result covers one commit under our scan policy, so review what access you give it and check any advisories shown here.

What it can access

  • An MCP server is a program your AI app starts and talks to. A local one runs with your user's permissions: it can see the files, environment variables and network your account can.
  • Based on its description and topics, it likely needs to control a web browser (visit sites, fill in and submit forms).

Before you install

  1. Run it in a separate browser profile without your logged-in accounts.
  2. Pin the version you reviewed instead of always installing the latest release.
  3. Read the tool list or scripts before the first run, and keep approval prompts on for actions that write, send or delete.
  • Maintained by samihalawa on GitHub, 84 stars and 10 forks. Popularity is not proof of safety.
  • Last code change: Oct 1, 2026.
  • Open-source license: ISC.
Read the scan reportWhat our scan checks

Tools Visual UI Debug Agent MCP exposes (29)

Listed by the server itself during our scan of commit 33af9e8.

  • enhanced_page_analyzer

    Analyze a page with screenshots, console logs, interactive element mapping, and performance metrics

  • api_endpoint_tester

    Test multiple API endpoints and verify responses

  • navigation_flow_validator

    Test a sequence of user actions across multiple pages

  • screenshot_url

    Take a screenshot of a URL

  • dom_inspector

    Inspect DOM elements and their properties

  • batch_screenshot_urls

    Capture screenshots of multiple URLs in a grid layout for easy comparison

  • console_monitor

    Monitor console logs on a page

  • performance_analysis

    Analyze page performance metrics

  • visual_comparison

    Compare two URLs visually and highlight differences

  • screenshot_local_files

    Take screenshots of local HTML files in a directory

  • playwright_navigate

    Navigate to a URL

  • playwright_click

    Click an element on the page

  • playwright_iframe_click

    Click an element in an iframe on the page

  • playwright_fill

    Fill out an input field

  • playwright_select

    Select an option in a dropdown

  • playwright_hover

    Hover over an element on the page

  • playwright_evaluate

    Execute JavaScript in the browser console context

  • playwright_console_logs

    Retrieve console logs captured so far

  • playwright_get_visible_text

    Get the visible text content of the current page

  • playwright_get_visible_html

    Get the HTML content of the current page

  • playwright_go_back

    Navigate back in browser history

  • playwright_go_forward

    Navigate forward in browser history

  • playwright_press_key

    Press a keyboard key (optionally focusing an element first)

  • playwright_drag

    Drag an element to a target location

  • playwright_screenshot

    Take a screenshot of the current page or a specific element

  • ui_workflow_validator

    Execute and validate a sequence of UI interactions simulating a user workflow.

  • tunnel_helper

    Guide user to expose local ports via Cloudflare tunnel or manage tunnel URLs

  • debug_memory

    Save and retrieve debugging context including .env variables, selectors, and issues

  • sitemap_crawler

    Crawl a website recursively to generate a comprehensive sitemap with all endpoints, links, and visible text content. Perfect for detecting inconsistent content, broken links, and navigation issues.

Visual UI Debug Agent MCP is an open-source mcp server by samihalawa, written mainly in JavaScript. Visual UI testing and debugging MCP server with Playwright, screenshots, DOM inspection, workflow validation, and visual diffs.

At a glance

Stars
84
Forks
10
Language
JavaScript
License
ISC
Created
May 2025
Last update
Oct 1, 2026
Type
MCP Server
Price
Free

Topics

agentaiautomatedautomationautonomous-agentsbrowserdebugginggptmcpmcp-serverplaywrighttypescriptuiui-testingvisual-testing

Questions about Visual UI Debug Agent MCP

What is Visual UI Debug Agent MCP?

Visual UI testing and debugging MCP server with Playwright, screenshots, DOM inspection, workflow validation, and visual diffs.

Who maintains Visual UI Debug Agent MCP?

Visual UI Debug Agent MCP is maintained by samihalawa on GitHub (samihalawa/visual-ui-debug-agent-mcp). AgenticMart lists it from public repository data.

Is Visual UI Debug Agent MCP safe to use?

AgenticMart scanned Visual UI Debug Agent MCP on Nov 5, 2026 with automated checks for hidden code, known-malicious packages, leaked secrets and vulnerable dependencies. The result covers one commit under our scan policy, so review what access you give it and check any advisories shown here.

What license does Visual UI Debug Agent MCP use?

It is published under the ISC license.

Visual UI Debug Agent MCP alternatives

View more →

Similar mcp servers in Coding Agents, ranked by GitHub stars. Compare licence, recent activity and scan status before you choose.

NameStarsLicenceLast updatedScan
Visual UI Debug Agent MCP (this page)
samihalawa
84ISCOct 1, 2026Scanned, no flagged issues
Context Mode
mksglu
33kNone foundNov 1, 2026Not scanned yet
Serena
oraios
31kNone foundOct 28, 2026Not scanned yet
Fastmcp
PrefectHQ
28kApache-2.0Nov 1, 2026Scanned, no flagged issues
Nuclear
nukeop
19kAGPL-3.0Nov 1, 2026Scanned, no flagged issues
MCP For Beginners
microsoft
18kMITOct 30, 2026Scanned, no flagged issues